Proteintech, 21434-1-AP, ADAM21 Polyclonal antibody

Size: 20ul / 150ul The ADAM21 (21434-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM21 in WB, ELISA applications with reactivity to human samples 21434-1-AP targets ADAM21 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ADAM21 is also present in growing axonal tracts during postnatal development and in growing primary olfactory axons in adults. In the olfactory nerve layer, ADAM21 often, but not always, colocalizes with OMP, a marker of mature olfactory neurons, but is not colocalized with the immature marker βIII-tubulin. The exclusive expression of ADAM21 in human testis and its sequence similarity with the fertilins suggest that it is also expressed on sperm cells and involved in sperm maturation and/or fertilization(PMID:9469942). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16042 Product name: Recombinant human ADAM21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-408 aa of BC109024 Sequence: SMYQQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFSQWKQISLSQLQHDAAHMFIKNSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQHDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKR Predict reactive species Full Name: ADAM metallopeptidase domain 21 Calculated Molecular Weight: 722 aa, 81 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC109024 Gene Symbol: ADAM21 Gene ID (NCBI): 8747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.