Product Description
Size: 20ul / 150ul
The PEA15 (21446-1-AP) by Proteintech is a Polyclonal antibody targeting PEA15 in WB, IHC, ELISA applications with reactivity to human, mouse samples
21446-1-AP targets PEA15 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: fetal human brain tissue
Positive IHC detected in: mouse brain tissue, human heart tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species
Full Name: phosphoprotein enriched in astrocytes 15
Calculated Molecular Weight: 130 aa, 15 kDa
Observed Molecular Weight: 15-18 kDa
GenBank Accession Number: BC002426
Gene Symbol: PEA15
Gene ID (NCBI): 8682
RRID: AB_2878858
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q15121
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924