Iright
BRAND / VENDOR: Proteintech

Proteintech, 21459-1-AP, TOR1AIP1 Polyclonal antibody

CATALOG NUMBER: 21459-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TOR1AIP1 (21459-1-AP) by Proteintech is a Polyclonal antibody targeting TOR1AIP1 in WB, IF/ICC, ELISA applications with reactivity to human samples 21459-1-AP targets TOR1AIP1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, HEK-293T cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14823 Product name: Recombinant human TOR1AIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC023247 Sequence: MKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWW Predict reactive species Full Name: torsin A interacting protein 1 Calculated Molecular Weight: 462aa,52 kDa; 583aa,66 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC023247 Gene Symbol: TOR1AIP1 Gene ID (NCBI): 26092 RRID: AB_2878861 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JTV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924