Proteintech, 21460-1-AP, PRH1 Polyclonal antibody

Size: 20ul / 150ul The PRH1 (21460-1-AP) by Proteintech is a Polyclonal antibody targeting PRH1 in WB, IF/ICC, ELISA applications with reactivity to human samples 21460-1-AP targets PRH1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PRH1, also known as Salivary acidic proline-rich phosphoprotein 1/2, is a 166 amino acid secreted protein whose molecular weight is 17 kDa. It functions as a highly potent inhibitor of calcium phosphate crystal growth. Similar to other PRPs, PRH1 provides a protective and reparative environment for dental enamel, which is important for teeth integrity. This antibody specifically recognises the 17 kDa protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14833 Product name: Recombinant human PRH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 17-187 aa of BC064553 Sequence: QDLNEDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ Predict reactive species Full Name: proline-rich protein HaeIII subfamily 1 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC064553 Gene Symbol: PRH1 Gene ID (NCBI): 5554 RRID: AB_2878862 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02810 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.