Proteintech, 21463-1-AP, C1orf57 Polyclonal antibody

Size: 20ul / 150ul The C1orf57 (21463-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf57 in WB, ELISA applications with reactivity to human, mouse, rat samples 21463-1-AP targets C1orf57 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human brain tissue, mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15009 Product name: Recombinant human C1orf57 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-190 aa of BC005102 Sequence: MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK Predict reactive species Full Name: chromosome 1 open reading frame 57 Calculated Molecular Weight: 190 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC005102 Gene Symbol: C1orf57 Gene ID (NCBI): 84284 RRID: AB_10734586 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.