Proteintech, 21492-1-AP, VANGL2 Polyclonal antibody

Size: 20ul / 150ul The VANGL2 (21492-1-AP) by Proteintech is a Polyclonal antibody targeting VANGL2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21492-1-AP targets VANGL2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HepG2 cells, mouse brain tissue, rat brain tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15833 Product name: Recombinant human VANGL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species Full Name: vang-like 2 (van gogh, Drosophila) Calculated Molecular Weight: 521 aa, 60 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC103920 Gene Symbol: VANGL2 Gene ID (NCBI): 57216 RRID: AB_11182263 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.