Iright
BRAND / VENDOR: Proteintech

Proteintech, 21505-1-AP, Arp5/ACTR5 Polyclonal antibody

CATALOG NUMBER: 21505-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Arp5/ACTR5 (21505-1-AP) by Proteintech is a Polyclonal antibody targeting Arp5/ACTR5 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21505-1-AP targets Arp5/ACTR5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human skeletal muscle tissue, mouse cerebellum tissue, mouse heart tissue, mouse ovary tissue, rat heart tissue Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Arp5 is a member of nuclear actin-related proteins (ARPs) that function as components of the chromatin- remodeling complex. Recently study reported that Arp5 regulates smooth muscle cell differentiation through interaction with myocardin (Myocd). Arp5 has been identified as negative regulator of Myocd, suppressing Myocd activity in the nucleus through tightly binding with Myocd RPEL motifs. Alternative splicing results in two variants of Arp5: a broadly expressed arp5-common, and a smooth muscle restricted arp5-sm. Expression of Arp5-sm protein is strongly suppressed in well-differentiated smooth muscle cells by partial messenger RNA decay and translational suppression. (24567363) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15976 Product name: Recombinant human ACTR5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 258-607 aa of BC038402 Sequence: EELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERLQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDVQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGGGGAGEQA Predict reactive species Full Name: ARP5 actin-related protein 5 homolog (yeast) Calculated Molecular Weight: 607 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC038402 Gene Symbol: ARP5/ACTR5 Gene ID (NCBI): 79913 RRID: AB_10733470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9F9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924