Proteintech, 21513-1-AP, HAND2 Polyclonal antibody

Size: 20ul / 150ul The HAND2 (21513-1-AP) by Proteintech is a Polyclonal antibody targeting HAND2 in WB, ELISA applications with reactivity to human samples 21513-1-AP targets HAND2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information HAND2 is a bHLH transcription factor essential for cardiac morphogenesis, neural crest differentiation, and limb development. Acting in the nucleus, it regulates gene networks shaping embryonic heart structure, craniofacial patterning, and limb polarity. Dysregulation of HAND2 is linked to congenital heart defects, craniofacial disorders, and certain cancers, highlighting its importance in both development and disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16038 Product name: Recombinant human HAND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC101406 Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYAS Predict reactive species Full Name: heart and neural crest derivatives expressed 2 Calculated Molecular Weight: 217 aa, 24 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC101406 Gene Symbol: HAND2 Gene ID (NCBI): 9464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.