Product Description
Size: 20ul / 150ul
The LHX6 (21516-1-AP) by Proteintech is a Polyclonal antibody targeting LHX6 in WB, ELISA applications with reactivity to human samples
21516-1-AP targets LHX6 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
LHX6 is a LIM homeodomain protein similar in structure to ISL-1. LHX6, like ISL-1, contains tandem LIM domains and a homeodomain that regulate its activity both in cis and through interaction with cell-specific factors. LHX6 is highly expressed in the neural crest-derived mesenchyme throughout odontogenesis and down-regulated after birth. However, LHX6 is also expressed in the palate, oral, and dental epithelium during craniofacial development. LHX6 regulates the migration and specification of neuron subtypes and marks specific neurons. The molecular weight of Endogenous LHX6 is 40 kDa, but the LHX6-PITX2 protein complex is 56 kDa (PMID: 23229549).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16047 Product name: Recombinant human LHX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-363 aa of BC103937 Sequence: KHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY Predict reactive species
Full Name: LIM homeobox 6
Calculated Molecular Weight: 392 aa, 43 kDa
Observed Molecular Weight: 40 kDa
GenBank Accession Number: BC103937
Gene Symbol: LHX6
Gene ID (NCBI): 26468
RRID: AB_2878875
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UPM6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924