Iright
BRAND / VENDOR: Proteintech

Proteintech, 21519-1-AP, Frizzled 5 Polyclonal antibody

CATALOG NUMBER: 21519-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Frizzled 5 (21519-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21519-1-AP targets Frizzled 5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, COLO 320 cells, Jurkat cells, PC-3 cells, mouse lung tissue, PC-12 cells, mouse colon tissue, mouse small intestine tissue, rat colon tissue Positive IHC detected in: human stomach cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Fzd5, is the receptor for the Wnt5A ligand. Fzd5 modulates cell fate and cell behavior during vertebrate development. It regulates hematopoiesis by the antagonism of the canonical Wnt pathway, resulting in a pool of quiescent hematopoietic stem cells, and regulates hematopoietic stem cell function in a paracrine fashion through several distinct mechanisms including modulating canonical Wnt signaling. It acts through noncanonical Wnt signaling to promote angiogenesis. It is also involved in control cell orientation, polarity, and directional movement in response to positional cues from chemokine gradients. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16082 Product name: Recombinant human FZD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 524-585 aa of BC114346 Sequence: GKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV Predict reactive species Full Name: frizzled homolog 5 (Drosophila) Calculated Molecular Weight: 585 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC114346 Gene Symbol: FZD5 Gene ID (NCBI): 7855 RRID: AB_2878877 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13467 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924