Product Description
Size: 20ul / 150ul
The ITK (21525-1-AP) by Proteintech is a Polyclonal antibody targeting ITK in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
21525-1-AP targets ITK in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, mouse spleen tissue
Positive IF/ICC detected in: Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16132 Product name: Recombinant human ITK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-258 aa of BC109077 Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK Predict reactive species
Full Name: IL2-inducible T-cell kinase
Calculated Molecular Weight: 620 aa, 72 kDa
Observed Molecular Weight: 68-72 kDa
GenBank Accession Number: BC109077
Gene Symbol: ITK
Gene ID (NCBI): 3702
RRID: AB_10733884
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q08881
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924