Iright
BRAND / VENDOR: Proteintech

Proteintech, 21528-1-AP, L1TD1 Polyclonal antibody

CATALOG NUMBER: 21528-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The L1TD1 (21528-1-AP) by Proteintech is a Polyclonal antibody targeting L1TD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21528-1-AP targets L1TD1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCCIT cells Positive IHC detected in: human ovary cancer tissue, human ovary tumor tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NCCIT cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information L1TD1 is an RNA-binding protein highly and specifically expressed in pluripotent cells. It is essential for maintaining the pluripotentency in human embryonic stem cells (hESCs) and has been considered as a marker for undifferentiated hESCs. L1TD1 is also reported to be highly expressed in medulloblastoma cells and its expression in medulloblastoma correlates with poor clinical outcome. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16147 Product name: Recombinant human L1TD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 522-865 aa of BC111559 Sequence: KLVKHQVVHKTQEEEETAVPTSQGTGTPCLTLCLASPSKSLEMSHDEHKKHSHTNLSISTGVTKLKKTEEKKHRTLHTEELTSKEADLTEETEENLRSSVINSIREIKEEIGNLKSSHSGVLEIENSVDDLSSRMDILEERIDSLEDQIEEFSKDTMQMTKQIISKERQRDIEERSRSCNIRLIGIPEKESYENRAEDIIKEIIDENFAELKKGSSLEIVSACRVPSKIDEKRLTPRHILVKFWNSSDKEKIIRASRERREITYQGTRIRLTADLSLDTLDARSKWSNVFKVLLEKGFNPRILYPAKMAFDFRGKTKVFLSIEEFRDYVLHMPTLRELLGNNIP Predict reactive species Full Name: LINE-1 type transposase domain containing 1 Calculated Molecular Weight: 865 aa, 99 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC111559 Gene Symbol: L1TD1 Gene ID (NCBI): 54596 RRID: AB_2878878 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T7N2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924