Proteintech, 21537-1-AP, FAM134B Polyclonal antibody

Size: 20ul / 150ul The FAM134B (21537-1-AP) by Proteintech is a Polyclonal antibody targeting FAM134B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 21537-1-AP targets FAM134B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, HEK-293 cells, rat brain tissue, mouse brain, mouse cerebellum Positive IP detected in: Jurkat cells Positive IHC detected in: mouse brain tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM134B, also known as the reticulophagy regulator 1 (RETREG1) or JK-1, is a member of the family with sequence similarity 134. FAM134B is an important ER-phagy receptor. FAM134B regulates the size and shape of the ER and participates in some ER-phagy-related processes(PMID: 33199694). FAM134B inhibition contributes to impair proteostasis in the ER due to the accumulation of misfolded or aggregated proteins, which in turn leads to compromised neuronal survival and progressive neuronal degenerative diseases. In addition, FAM134B mutations are common in patients with colorectal adenocarcinoma, and oesophageal squamous cell carcinoma(PMID: 29226326). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16176 Product name: Recombinant human FAM134B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-455 aa of BC030517 Sequence: ELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDF Predict reactive species Full Name: family with sequence similarity 134, member B Calculated Molecular Weight: 497 aa, 55 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC030517 Gene Symbol: FAM134B Gene ID (NCBI): 54463 RRID: AB_2878879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.