Product Description
Size: 20ul / 150ul
The FCGR2B / CD32b (21541-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR2B / CD32b in WB, IHC, ELISA applications with reactivity to human samples
21541-1-AP targets FCGR2B / CD32b in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human placenta tissue, Raji cells
Positive IHC detected in: human tonsillitis tissue, human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16189 Product name: Recombinant human FCGR2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-310 aa of BC031992 Sequence: ALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI Predict reactive species
Full Name: Fc fragment of IgG, low affinity IIb, receptor (CD32)
Calculated Molecular Weight: 310 aa, 34 kDa
Observed Molecular Weight: 36 kDa
GenBank Accession Number: BC031992
Gene Symbol: CD32b
Gene ID (NCBI): 2213
RRID: AB_2878881
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P31994
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924