Proteintech, 21550-1-AP, ASZ1 Polyclonal antibody

Size: 20ul / 150ul The ASZ1 (21550-1-AP) by Proteintech is a Polyclonal antibody targeting ASZ1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 21550-1-AP targets ASZ1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16217 Product name: Recombinant human ASZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-372 aa of BC034963 Sequence: SEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLIT Predict reactive species Full Name: ankyrin repeat, SAM and basic leucine zipper domain containing 1 Calculated Molecular Weight: 475 aa, 53 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC034963 Gene Symbol: ASZ1 Gene ID (NCBI): 136991 RRID: AB_10858622 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWH4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.