Proteintech, 21564-1-AP, TOAG1 Polyclonal antibody

Size: 20ul / 150ul The TOAG1 (21564-1-AP) by Proteintech is a Polyclonal antibody targeting TOAG1 in WB, IHC, ELISA applications with reactivity to human samples 21564-1-AP targets TOAG1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TOAG1, also named as TCAIM and C3orf23, is a mitochondrial protein which regulates T-cell apoptosis. It is a specific and reproducible marker for quiescence. TOAG1 has two isoforms with MW 41 kDa and 58 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16067 Product name: Recombinant human C3orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-496 aa of BC101060 Sequence: TQPLKEAKRMPDRPIKWDKSYYSFTGFKDPDEDLEQVSRVETTLTSWLDNNGKSAVKKLKNSLPLRKELDRLKDELSHQLQLSDIRWQRSWGIAHRCSQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVGHVMLGTMDVHHHWTKLFERLPSYFDLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYNRLLKSRILFHPRSLRGLQMILNSDRYAPSLHELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKVIENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRLLEQSLPYLHGMHLCISHFYSVMQDGDLCIPWNWKNGEAIK Predict reactive species Full Name: chromosome 3 open reading frame 23 Calculated Molecular Weight: 496 aa, 58 kDa Observed Molecular Weight: 35-41 kDa GenBank Accession Number: BC101060 Gene Symbol: TOAG1 Gene ID (NCBI): 285343 RRID: AB_2878885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3R3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.