Iright
BRAND / VENDOR: Proteintech

Proteintech, 21572-1-AP, JMJD4 Polyclonal antibody

CATALOG NUMBER: 21572-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The JMJD4 (21572-1-AP) by Proteintech is a Polyclonal antibody targeting JMJD4 in WB, ELISA applications with reactivity to human samples 21572-1-AP targets JMJD4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information JMJD4 (JmjC domain-containing protein 4, Jumonji domain-containing protein 4) is a member of the JmjC domain-containing proteins. Several JmjC domain-containing proteins have been reported to play a crucial role in the control of gene expression by acting as protein hydroxylases or histone demethylases (PMID: 16983801; 21300889). The function of JMJD4 protein remains unknown. The gene of JMJD4 maps to chromosome 1q42.13. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16099 Product name: Recombinant human JMJD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 114-463 aa of BC109272 Sequence: RRRWVTPAGRPDFDHLLRTYGDVVVPVANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNEFWDALDVDDYRFVYAGPAGSWSPFHADIFRSFSWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPALCDTHLHPRNQLAGPPLEITQEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRLLQQELCAVQEEVSEWRDSMPDWHHHCQVIMRSCSGINFEEFYHFLKVIAEKRLLVLREAAAEDGAGLGFEQAAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP Predict reactive species Full Name: jumonji domain containing 4 Calculated Molecular Weight: 463 aa, 52 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC109272 Gene Symbol: JMJD4 Gene ID (NCBI): 65094 RRID: AB_2878886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9V9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924