Proteintech, 21573-1-AP, MOGAT1 Polyclonal antibody

Size: 20ul / 150ul The MOGAT1 (21573-1-AP) by Proteintech is a Polyclonal antibody targeting MOGAT1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 21573-1-AP targets MOGAT1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16109 Product name: Recombinant human MOGAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 152-335 aa of BC146518 Sequence: REYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK Predict reactive species Full Name: monoacylglycerol O-acyltransferase 1 Calculated Molecular Weight: 335 aa, 39 kDa GenBank Accession Number: BC146518 Gene Symbol: MOGAT1 Gene ID (NCBI): 116255 RRID: AB_10734589 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.