Proteintech, 21576-1-AP, RHOG Polyclonal antibody

Size: 20ul / 150ul The RHOG (21576-1-AP) by Proteintech is a Polyclonal antibody targeting RHOG in WB, IP, ELISA applications with reactivity to human samples 21576-1-AP targets RHOG in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, MCF-7 cells, K-562 cells Positive IP detected in: Jurkat cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RHOG, also named as ARHG, belongs to the small GTPase superfamily and Rho family. It is required for the formation of membrane ruffles during macropinocytosis. And it is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, it is activated by SopB and SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. This antibody is specific to RHOG. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16118 Product name: Recombinant human RHOG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 74-191 aa of BC104178 Sequence: QTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL Predict reactive species Full Name: ras homolog gene family, member G (rho G) Calculated Molecular Weight: 191 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC104178 Gene Symbol: RHOG Gene ID (NCBI): 391 RRID: AB_2878887 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P84095 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.