Proteintech, 21583-1-AP, ZNF75D Polyclonal antibody

Size: 20ul / 150ul The ZNF75D (21583-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF75D in WB, ELISA applications with reactivity to human, mouse samples 21583-1-AP targets ZNF75D in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information ZNF75D (zinc finger protein 75D), also known as ZNF75. It is expected to be located in nucleus and ubiquitous expression in prostate and adrenal. The calculated molecular weight of METAP1 is 60 kDa. The gene encodes a protein that likely functions as a transcription factor. ZNF75D belongs to the ZNF75 family, includes an N-terminal SCAN domain, a KRAB box, and five C2H2-type zinc finger motifs. Another functional gene belonging to this family is located on chromosome 16, while pseudogenes have been identified on chromosomes 11 and 12 (PMID: 8661144). It may be involved in transcriptional regulation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16139 Product name: Recombinant human ZNF75D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-233 aa of BC109100 Sequence: AEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLS Predict reactive species Full Name: zinc finger protein 75D Calculated Molecular Weight: 510 aa, 59 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC109100 Gene Symbol: ZNF75D Gene ID (NCBI): 7626 RRID: AB_3085661 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51815 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.