Iright
BRAND / VENDOR: Proteintech

Proteintech, 21592-1-AP, ZNF404 Polyclonal antibody

CATALOG NUMBER: 21592-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF404 (21592-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF404 in WB, ELISA applications with reactivity to human, mouse samples 21592-1-AP targets ZNF404 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZNF404 (Zinc Finger Protein 404) is a putative transcription factor belonging to the Krüppel-associated box (KRAB) zinc finger protein (KZFP) family. ZNF404 is predicted to function as a DNA-binding transcription factor that regulates RNA polymerase II-mediated transcription, potentially acting as a transcriptional repressor. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16166 Product name: Recombinant human ZNF404 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-271 aa of BC101333 Sequence: LDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTIEFGRQQRPKVGCFSQMIFKKHKSLPLHKRNNTREKSYECKEYKKGFRKYLHLTEHLRDHTGVIPYECNECGKAFVVFQHFIRHRKIHTDLKPYECNGCEKAFRFYSQLIQHQIIHTGMKPYECKQCGKAFRRHSHLTEHQKIHVGLKPFECKECGETFRLYRHMCLHQKIHHGVKPY Predict reactive species Full Name: zinc finger protein 404 Calculated Molecular Weight: 552 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC101333 Gene Symbol: ZNF404 Gene ID (NCBI): 342908 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q494X3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924