Iright
BRAND / VENDOR: Proteintech

Proteintech, 21601-1-AP, LRRC8C Polyclonal antibody

CATALOG NUMBER: 21601-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LRRC8C (21601-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC8C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21601-1-AP targets LRRC8C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LRRC8C (Leucine-rich repeat-containing protein 8C), also known as AD158, is a non-essential component of the volume-regulated anion channel (VRAC, also known as VSOAC channel), which is required to maintain a constant cell volume in response to extracellular or intracellular permeability changes. The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine. The VRAC channel also mediates transport of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol (PMID:24790029; 26824658; 28193731). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16213 Product name: Recombinant human LRRC8C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 618-803 aa of BC113973 Sequence: DLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRAGLVVEDALFETLPSDVREQMKTE Predict reactive species Full Name: leucine rich repeat containing 8 family, member C Calculated Molecular Weight: 803 aa, 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC113973 Gene Symbol: LRRC8C Gene ID (NCBI): 84230 RRID: AB_10733648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDW0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924