Proteintech, 21613-1-AP, Adiponectin Polyclonal antibody

Size: 20ul / 150ul The Adiponectin (21613-1-AP) by Proteintech is a Polyclonal antibody targeting Adiponectin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21613-1-AP targets Adiponectin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma, NIH/3T3 cells, 3T3-L1 cells Positive IHC detected in: rat brown adipose tissue, human placenta tissue, human prostate cancer tissue, human skin tissue, mouse brown adipose tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: 3T3-L1 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving INS sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, sheep, goat, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16304 Product name: Recombinant human ADIPOQ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC096308 Sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN Predict reactive species Full Name: adiponectin, C1Q and collagen domain containing Calculated Molecular Weight: 244 aa, 26 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC096308 Gene Symbol: Adiponectin Gene ID (NCBI): 9370 RRID: AB_2878891 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15848 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.