Iright
BRAND / VENDOR: Proteintech

Proteintech, 21617-1-AP, MRP63 Polyclonal antibody

CATALOG NUMBER: 21617-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MRP63 (21617-1-AP) by Proteintech is a Polyclonal antibody targeting MRP63 in WB, IHC, ELISA applications with reactivity to human samples 21617-1-AP targets MRP63 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Mitochondrial ribosomal protein 63 is a component of the mitochondrial Large ribosomal subunit (mt-LSU), also known as the Large ribosomal subunit protein mL63. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7289 Product name: Recombinant human MRP63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC000002 Sequence: MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS Predict reactive species Full Name: mitochondrial ribosomal protein 63 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC000002 Gene Symbol: MRP63 Gene ID (NCBI): 78988 RRID: AB_3085663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924