Iright
BRAND / VENDOR: Proteintech

Proteintech, 21630-1-AP, ZSCAN29 Polyclonal antibody

CATALOG NUMBER: 21630-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZSCAN29 (21630-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN29 in WB, IHC, ELISA applications with reactivity to human samples 21630-1-AP targets ZSCAN29 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human colon tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ZSCAN29 (zinc finger and SCAN domain containing 29), also named as ZNF690 or Zfp690. It is predicted to be located in nucleus and ubiquitous expression in testis and lymph node. The calculated molecular weight of ZSCAN29 is 96 kDa. The genes ZSCAN29 (associated with five disorders: SCZ, BIP, MD, ASD and ADHD) and ZSCAN31 (associated with three disorders: SCZ, BIP and MD) encode zing finger transcription factor proteins that belong to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are essential in multiple regulatory mechanisms and some have been associated with psychiatric disorders as reviewed by Squassina et al., 2019 (PMID: 34637873). It also enables sequence-specific double-stranded DNA binding activity and be predicted to be involved in regulation of transcription by RNA polymerase II. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16239 Product name: Recombinant human ZSCAN29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-304 aa of BC109271 Sequence: PGRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQRPCLGERPYKYLKYSKSFGPNSLLMHQVSHQVENPYKCADCGKSFSRSARLI Predict reactive species Full Name: zinc finger and SCAN domain containing 29 Calculated Molecular Weight: 852 aa, 97 kDa Observed Molecular Weight: 96-97 kDa GenBank Accession Number: BC109271 Gene Symbol: ZSCAN29 Gene ID (NCBI): 146050 RRID: AB_3085664 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924