Iright
BRAND / VENDOR: Proteintech

Proteintech, 21639-1-AP, GBX2 Polyclonal antibody

CATALOG NUMBER: 21639-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GBX2 (21639-1-AP) by Proteintech is a Polyclonal antibody targeting GBX2 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 21639-1-AP targets GBX2 in WB, IHC, IF/ICC, IP, chIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse stomach tissue, HeLa cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Homeobox protein GBX-2 (GBX-2) is a homeobox gene essential for normal development of the midbrain and the anterior hindbrain. It mainly expressed in the brain, and located in nucleoplasm. It is presumably a transcription factor that is likely to regulate the expression of genes involved in establishing early A/P pattern in the neural plate (PMID: 9247335). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16288 Product name: Recombinant human GBX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-248 aa of BC137448 Sequence: LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNR Predict reactive species Full Name: gastrulation brain homeobox 2 Calculated Molecular Weight: 348 aa, 37 kDa Observed Molecular Weight: 33-37 kDa GenBank Accession Number: BC137448 Gene Symbol: GBX2 Gene ID (NCBI): 2637 RRID: AB_2878896 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52951 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924