Product Description
Size: 20ul / 150ul
The AKT3 (21641-1-AP) by Proteintech is a Polyclonal antibody targeting AKT3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
21641-1-AP targets AKT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
AKT3, also named as PKBG, is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. AKT3 is a key modulator of several tumors like melanoma, glioma and ovarian cancer. Active AKT3 increases progressively during melanoma tumor progression with highest levels present in advanced-stage metastatic melanomas.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16298 Product name: Recombinant human AKT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-155 aa of BC121154 Sequence: REEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLG Predict reactive species
Full Name: v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Calculated Molecular Weight: 465 aa, 54 kDa
Observed Molecular Weight: 60 kDa
GenBank Accession Number: BC121154
Gene Symbol: AKT3
Gene ID (NCBI): 10000
RRID: AB_10733649
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y243
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924