Proteintech, 21645-1-AP, ROCK2(middle) Polyclonal antibody

Size: 20ul / 150ul The ROCK2(middle) (21645-1-AP) by Proteintech is a Polyclonal antibody targeting ROCK2(middle) in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21645-1-AP targets ROCK2(middle) in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, mouse brain tissue, HeLa cells, mouse lung tissue, MCF-7 cells, mouse liver tissue, L02 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16330 Product name: Recombinant human ROCK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC111801 Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ Predict reactive species Full Name: Rho-associated, coiled-coil containing protein kinase 2 Calculated Molecular Weight: 77 kDa, 161 kDa Observed Molecular Weight: 161 kDa GenBank Accession Number: BC111801 Gene Symbol: ROCK2 Gene ID (NCBI): 9475 RRID: AB_10858624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75116 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.