Iright
BRAND / VENDOR: Proteintech

Proteintech, 21647-1-AP, GIRK2 Polyclonal antibody

CATALOG NUMBER: 21647-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GIRK2 (21647-1-AP) by Proteintech is a Polyclonal antibody targeting GIRK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21647-1-AP targets GIRK2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GIRK2 (also known as Kir3.2), encoded by KCNJ6 gene, is a member of the G protein-coupled inwardly-rectifying potassium channel (GIRK, Kir3) family of inward rectifier potassium channels. GIRK channels are activated following stimulation of G protein-coupled receptors (PMID: 26422984). They play important roles in regulating cellular excitabilities in the heart and brain (PMID: 31043612). Mutations in KCNJ6 gene are associated with Keppen-Lubinsky Syndrome (PMID: 25620207). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16344 Product name: Recombinant human KCNJ6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-423 aa of BC101547 Sequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV Predict reactive species Full Name: potassium inwardly-rectifying channel, subfamily J, member 6 Calculated Molecular Weight: 423 aa, 48 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC101547 Gene Symbol: GIRK2 Gene ID (NCBI): 3763 RRID: AB_10794447 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48051 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924