Iright
BRAND / VENDOR: Proteintech

Proteintech, 21653-1-AP, HOXB1 Polyclonal antibody

CATALOG NUMBER: 21653-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HOXB1 (21653-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21653-1-AP targets HOXB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, NIH/3T3 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information HOXB1, also named as HOX2I, belongs to the Antp homeobox family and the Labial subfamily. HOXB1 is sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HOXB1 acts on the anterior body structures. Establishment of the spatial colinearity in the embryo is directly controlled by the Hox genes themselves. 21653-1-AP is a rabbit polyclonal antibody raised against residues near the N-terminus of human HOXB1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16366 Product name: Recombinant human HOXB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC096192 Sequence: MDYNRMNSFLEYPLCNRGPSAYSAHSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGHSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKE Predict reactive species Full Name: homeobox B1 Calculated Molecular Weight: 235 aa, 26 kDa Observed Molecular Weight: 32, 25 kDa GenBank Accession Number: BC096192 Gene Symbol: HOXB1 Gene ID (NCBI): 3211 RRID: AB_2878899 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924