Product Description
Size: 20ul / 150ul
The KRTAP3-1 (21673-1-AP) by Proteintech is a Polyclonal antibody targeting KRTAP3-1 in WB, ELISA applications with reactivity to human, mouse, rat samples
21673-1-AP targets KRTAP3-1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse skin tissue, rat skin tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
KRTAP3-1 is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16508 Product name: Recombinant human KRTAP3-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-98 aa of BC113077 Sequence: PHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC Predict reactive species
Full Name: keratin associated protein 3-1
Calculated Molecular Weight: 98 aa, 11 kDa
Observed Molecular Weight: 10-15 kDa
GenBank Accession Number: BC113077
Gene Symbol: KRTAP3-1
Gene ID (NCBI): 83896
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BYR8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924