Proteintech, 21679-1-AP, NANOS3 Polyclonal antibody

Size: 20ul / 150ul The NANOS3 (21679-1-AP) by Proteintech is a Polyclonal antibody targeting NANOS3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21679-1-AP targets NANOS3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HEK-293 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The NANOS gene family is required for germ cell development in diverse organisms. NANOS3 is found in migrating primordial germ cells, and the homozygous deficiency of NANOS3 in the mouse results in the complete loss of germ cells in both sexes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16014 Product name: Recombinant human NANOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC101209 Sequence: MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST Predict reactive species Full Name: nanos homolog 3 (Drosophila) Calculated Molecular Weight: 192 aa, 21 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC101209 Gene Symbol: NANOS3 Gene ID (NCBI): 342977 RRID: AB_10859250 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60323 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.