Iright
BRAND / VENDOR: Proteintech

Proteintech, 21681-1-AP, ZNF132 Polyclonal antibody

CATALOG NUMBER: 21681-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF132 (21681-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF132 in WB, ELISA applications with reactivity to human, mouse samples 21681-1-AP targets ZNF132 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZNF132, also named as Zinc finger protein 132, is a 706 amino-acid protein, which contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF132 belongs to the krueppel C2H2-type zinc-finger protein family and localizes in the nucleus. ZNF132 may be involved in transcriptional regulation. ZNF132 exists as two alternatively spliced isoforms, and is encoded by a gene that maps to human chromosome 19. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16142 Product name: Recombinant human ZNF132 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 299-602 aa of BC109107 Sequence: AFSHSSKLRKHQKFHTEVKYYECIACGKTFNHKLTFVHHQRIHSGERPYECDECGKAFSNRSHLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQVRPYECSQCGKSFSRSSALIQHWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHTGERPFECCDCGKAFSNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGEKPYECSECGKAFAHSSTLIEHWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYKCS Predict reactive species Full Name: zinc finger protein 132 Calculated Molecular Weight: 706 aa, 81 kDa Observed Molecular Weight: 81 and 68 kDa GenBank Accession Number: BC109107 Gene Symbol: ZNF132 Gene ID (NCBI): 7691 RRID: AB_2878903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52740 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924