Proteintech, 21696-1-AP, Teneurin 1 Polyclonal antibody

Size: 20ul / 150ul The Teneurin 1 (21696-1-AP) by Proteintech is a Polyclonal antibody targeting Teneurin 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21696-1-AP targets Teneurin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, H69/H146 cells, rat brain tissue Positive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ODZ1 (also known as teneurin-1, TENM1), which plays a key role in central nervous system ontogenesis. ODZ1 is upregulated in Glioblastoma cells through a Stat3-mediated pathway activated by IL-6, which is released by tumor-associated monocytes. In addition, a hypoxic microenvironment regulates GBM tumor cell migration in part by inducing ODZ1 through hypomethylation of a CpG island in the ODZ1 promoter. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16289 Product name: Recombinant human ODZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC140783 Sequence: MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHALRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDVQSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNY Predict reactive species Full Name: odz, odd Oz/ten-m homolog 1(Drosophila) Calculated Molecular Weight: 2732 aa, 306 kDa Observed Molecular Weight: 305 kDa GenBank Accession Number: BC140783 Gene Symbol: Teneurin 1 Gene ID (NCBI): 10178 RRID: AB_10858625 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.