Iright
BRAND / VENDOR: Proteintech

Proteintech, 21744-1-AP, BMT2 Polyclonal antibody

CATALOG NUMBER: 21744-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BMT2 (21744-1-AP) by Proteintech is a Polyclonal antibody targeting BMT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 21744-1-AP targets BMT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, U-87 MG cells, mouse liver, rat brain Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16476 Product name: Recombinant human C7orf60 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC114615 Sequence: MEPGAGGRNTARAQRAGSPNTPPPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDEETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNMHESSQLEGHLTNLSFTNPEFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLKQLKNPIDSLPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKISLKTTSDLVSRNYPGMLYIPQDFNSIEDE Predict reactive species Full Name: chromosome 7 open reading frame 60 Calculated Molecular Weight: 405 aa, 46 kDa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: BC114615 Gene Symbol: BMT2 Gene ID (NCBI): 154743 RRID: AB_2918073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q1RMZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924