Iright
BRAND / VENDOR: Proteintech

Proteintech, 21745-1-AP, VNN1 Polyclonal antibody

CATALOG NUMBER: 21745-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VNN1 (21745-1-AP) by Proteintech is a Polyclonal antibody targeting VNN1 in WB, ELISA applications with reactivity to human, mouse samples 21745-1-AP targets VNN1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: rat kidney tissue, BxPC-3 cells, mouse kidney tissue, PC-13 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information VNN1(Vascular non-inflammatory molecule 1) is also named as Vanin-1, Pantetheinase, Tiff66. It is a GPI-anchored 70-kDa protein with a high degree of homology with GPI-80 (also known as VNN2), a molecule expressed by human phagocytes and involved in leukocyte adhesion and migration. Vanin-1 is predominantly expressed by resident tissue cells and acts at the level of epithelial cells and surrounding hematopoietic cells by paracrine 2-Mercaptoethylamine release(PMID:17163446). The full length VNN1 has a signal peptide, a propeptide and six glycosylation sites. According to some authors, the variations which varied between 55 and 72kDa may be due to different degrees of glycosylation of the protein and cleavage (JOSE A et al. 2001). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16501 Product name: Recombinant human VNN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-513 aa of BC096268 Sequence: SQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTRFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW Predict reactive species Full Name: vanin 1 Calculated Molecular Weight: 513 aa, 57 kDa Observed Molecular Weight: 55-72 kDa GenBank Accession Number: BC096268 Gene Symbol: VNN1 Gene ID (NCBI): 8876 RRID: AB_10734328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95497 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924