Product Description
Size: 20ul / 150ul
The SLC25A2 (21764-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
21764-1-AP targets SLC25A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse kidney tissue, HeLa cells, mouse liver tissue
Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16360 Product name: Recombinant human SLC25A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC100935 Sequence: TACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQ Predict reactive species
Full Name: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2
Calculated Molecular Weight: 301 aa, 33 kDa
Observed Molecular Weight: 30-33 kDa
GenBank Accession Number: BC100935
Gene Symbol: SLC25A2
Gene ID (NCBI): 83884
RRID: AB_10858388
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BXI2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924