Product Description
Size: 20ul / 150ul
The GABRA6 (21766-1-AP) by Proteintech is a Polyclonal antibody targeting GABRA6 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples
21766-1-AP targets GABRA6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse cerebellum tissue
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:250-1:1000
Background Information
Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABAA receptors, which are ligand-gated chloride channels. GABAA receptors are formed by pentameric assembly of 19 different subunit subtypes (α1-α6, β1-β3, γ1-γ3, δ, ɛ, π, θ and ρ1-ρ3) (PMID: 21930603). The mutation R46W of GABRA6 is associated with the pathogenesis of childhood absence epilepsy (CAE) (PMID: 21930603).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16375 Product name: Recombinant human GABRA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 329-424 aa of BC096241 Sequence: NLQTQKAKRKAQFAAPPTVTISKATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQYSRIL Predict reactive species
Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 6
Calculated Molecular Weight: 453 aa, 51 kDa
GenBank Accession Number: BC096241
Gene Symbol: GABRA6
Gene ID (NCBI): 2559
RRID: AB_3085671
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q16445
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924