Proteintech, 21769-1-AP, DPF1 Polyclonal antibody

Size: 20ul / 150ul The DPF1 (21769-1-AP) by Proteintech is a Polyclonal antibody targeting DPF1 in WB, IF/ICC, ELISA applications with reactivity to human samples 21769-1-AP targets DPF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, PC-3 cells, mouse cerebellum tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16409 Product name: Recombinant human DPF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 84-193 aa of BC125153 Sequence: LNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDK Predict reactive species Full Name: D4, zinc and double PHD fingers family 1 Calculated Molecular Weight: 414 aa, 47 kDa Observed Molecular Weight: 38-47 kDa GenBank Accession Number: BC125153 Gene Symbol: DPF1 Gene ID (NCBI): 8193 RRID: AB_3085672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92782 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.