Iright
BRAND / VENDOR: Proteintech

Proteintech, 21774-1-AP, CACNA1C Polyclonal antibody

CATALOG NUMBER: 21774-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CACNA1C (21774-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 21774-1-AP targets CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: mouse brain tissue, rat brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Calcium voltage-gated channel subunit alpha1 C (CACNA1C, also known as CACH2 and Cav1.2) couples transient activation of inward calcium current to transcriptional regulation and plays an important role in dendritic development, neuronal survival, synaptic plasticity, memory formation, learning, and behavior (PMID: 21248242;  16251435; 20169575; 19047462; 18174367). Genetic variation in CACNA1C has also been associated with depression, schizophrenia, and autism spectrum disorders, as well as changes in brain function and structure in control subjects who have no diagnosable psychiatric illness (PMID: 22705413). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16455 Product name: Recombinant human L-VOCC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1835-2135 aa of BC146846 Sequence: EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL Predict reactive species Full Name: calcium channel, voltage-dependent, L type, alpha 1C subunit Calculated Molecular Weight: 249 kDa Observed Molecular Weight: 249 kDa GenBank Accession Number: BC146846 Gene Symbol: CACNA1C Gene ID (NCBI): 775 RRID: AB_2878918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924