Proteintech, 21825-1-AP, IFRG15 Polyclonal antibody

Size: 20ul / 150ul The IFRG15 (21825-1-AP) by Proteintech is a Polyclonal antibody targeting IFRG15 in IHC, ELISA applications with reactivity to human samples 21825-1-AP targets IFRG15 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IFRG15 is a 15 kDa interferon-responsive protein. It's different to the TOR1AIP2 isoform. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16156 Product name: Recombinant human IFRG15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC098348 Sequence: MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK Predict reactive species Full Name: interferon responsive gene 15 Calculated Molecular Weight: 470 aa, 51 kDa GenBank Accession Number: BC098348 Gene Symbol: IFRG15 Gene ID (NCBI): 64163 RRID: AB_2878922 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05BU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.