Proteintech, 21845-1-AP, PYROXD2 Polyclonal antibody

Size: 20ul / 150ul The PYROXD2 (21845-1-AP) by Proteintech is a Polyclonal antibody targeting PYROXD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21845-1-AP targets PYROXD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HEK-293T cells, L02 cells Positive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Pyridine Nucleotide-Disulfide Oxidoreductase Domain 2 (PYROXD2, previously called YueF, C10orf33) is a mitochondrial inner membrane/matrix-residing protein and is reported to regulate mitochondrial function. PYROXD2 is highly expressed in the cytoplasm of normal cells and tissues but is expressed at lower levels in corresponding cancer cells, including liver, lung and renal cell carcinoma and bladder cancer cells (PMID: 29048625, PMID: 35606887). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15004 Product name: Recombinant human C10orf33 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 232-581 aa of BC006131 Sequence: DQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLSSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM Predict reactive species Full Name: chromosome 10 open reading frame 33 Calculated Molecular Weight: 581 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC006131 Gene Symbol: PYROXD2 Gene ID (NCBI): 84795 RRID: AB_3669377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N2H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.