Product Description
Size: 20ul / 150ul
The CHT1 (21848-1-AP) by Proteintech is a Polyclonal antibody targeting CHT1 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples
21848-1-AP targets CHT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue
Positive IP detected in: mouse heart tissue
Positive IF-P detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16136 Product name: Recombinant human SLC5A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 457-580 aa of BC111525 Sequence: QPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ Predict reactive species
Full Name: solute carrier family 5 (choline transporter), member 7
Calculated Molecular Weight: 580 aa, 63 kDa
Observed Molecular Weight: 65-70 kDa
GenBank Accession Number: BC111525
Gene Symbol: CHT1
Gene ID (NCBI): 60482
RRID: AB_2878925
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9GZV3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924