Proteintech, 21849-1-AP, NRXN3 Polyclonal antibody

Size: 20ul / 150ul The NRXN3 (21849-1-AP) by Proteintech is a Polyclonal antibody targeting NRXN3 in WB, ELISA applications with reactivity to human, mouse samples 21849-1-AP targets NRXN3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16293 Product name: Recombinant human NRXN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-803 aa of BC152457 Sequence: STTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDG Predict reactive species Full Name: neurexin 3 Calculated Molecular Weight: 1061 aa, 117 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC152457 Gene Symbol: NRXN3 Gene ID (NCBI): 9369 RRID: AB_2878926 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4C0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.