Proteintech, 21862-1-AP, Intersectin 1 Polyclonal antibody

Size: 20ul / 150ul The Intersectin 1 (21862-1-AP) by Proteintech is a Polyclonal antibody targeting Intersectin 1 in WB, IHC, ELISA applications with reactivity to human samples 21862-1-AP targets Intersectin 1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IHC detected in: human stomach tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Intersectin 1 (ITSN1) is a multidomain adaptor protein that plays a crucial role in various cellular processes, particularly in the nervous system. It is involved in clathrin-mediated endocytosis, signal transduction, and the regulation of the actin cytoskeleton. The protein is highly abundant in neurons and has been implicated in neurodevelopmental disorders, such as autism spectrum disorders, intellectual disability, and epilepsy. Recent studies have identified de novo variants in the ITSN1 gene in patients with these disorders, suggesting a link between ITSN1 and brain development. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16517 Product name: Recombinant human ITSN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 610-926 aa of BC116186 Sequence: LREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRA Predict reactive species Full Name: intersectin 1 (SH3 domain protein) Calculated Molecular Weight: 1721 aa, 195 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC116186 Gene Symbol: Intersectin 1 Gene ID (NCBI): 6453 RRID: AB_2878931 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15811 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.