Iright
BRAND / VENDOR: Proteintech

Proteintech, 21881-1-AP, ATAD3C Polyclonal antibody

CATALOG NUMBER: 21881-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATAD3C (21881-1-AP) by Proteintech is a Polyclonal antibody targeting ATAD3C in WB, ELISA applications with reactivity to human samples 21881-1-AP targets ATAD3C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ATAD3 (ATPase family AAA Domain-containing protein 3) is a mitochondrial transmembrane protein involved in a variety of cellular processes. ATAD3 contains three isoforms: ATAD3A, ATAD3B and ATAD3C. ATAD3C has a negative dominant role in mitochondrial OXPHOS function and its expression regulates ATAD3A in cells (PMID: 38092275). This antibody can detect ATAD3C. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16422 Product name: Recombinant human ATAD3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC101211 Sequence: MPEDRTAGRVLAGHGVCLQGRGPDRGHDGRLRARLCPAAPADDALAEGGEAWARGRATLILSPWGDHTSRSLAADPSHPCLCGPAHLGNTPRNKVPRGPHRCVYWLTRGGVWGPLTSPWGQR Predict reactive species Full Name: ATPase family, AAA domain containing 3C Calculated Molecular Weight: 473 aa, 52 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC101211 Gene Symbol: ATAD3C Gene ID (NCBI): 219293 RRID: AB_3669379 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T2N8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924