Proteintech, 21901-1-AP, ANO10 Polyclonal antibody

Size: 20ul / 150ul The ANO10 (21901-1-AP) by Proteintech is a Polyclonal antibody targeting ANO10 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 21901-1-AP targets ANO10 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ANO10, also named as TMEM16K, is 660 amino acid protein, which belongs to the anoctamin family. ANO10 does not exhibit calcium-activated chloride channel activity and can inhibit the activity of ANO1. ANO10 is Highly expressed in the brain. ANO10 may have an association with Spinocerebellar ataxia, autosomal recessive, 10. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13983 Product name: Recombinant human ANO10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC038855 Sequence: MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPI Predict reactive species Full Name: anoctamin 10 Calculated Molecular Weight: 660 aa, 76 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC038855 Gene Symbol: ANO10 Gene ID (NCBI): 55129 RRID: AB_2878940 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NW15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.