Iright
BRAND / VENDOR: Proteintech

Proteintech, 21915-1-AP, OAS3 Polyclonal antibody

CATALOG NUMBER: 21915-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The OAS3 (21915-1-AP) by Proteintech is a Polyclonal antibody targeting OAS3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21915-1-AP targets OAS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, human placenta tissue, HeLa cells Positive IHC detected in: human skin cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS3, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). It is also named as p100 OAS and belongs to the 2-5A synthase family. OAS3 is involved in inhibition of cellular protein synthesis and in viral infection resistance. This antibody may have weak cross-reaction with OAS1 protein due to the highly homology. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16150 Product name: Recombinant human OAS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC113746 Sequence: MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC Predict reactive species Full Name: 2'-5'-oligoadenylate synthetase 3, 100kDa Calculated Molecular Weight: 1087 aa, 121 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC113746 Gene Symbol: OAS3 Gene ID (NCBI): 4940 RRID: AB_2876880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924