Iright
BRAND / VENDOR: Proteintech

Proteintech, 21916-1-AP, ONECUT2 Polyclonal antibody

CATALOG NUMBER: 21916-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ONECUT2 (21916-1-AP) by Proteintech is a Polyclonal antibody targeting ONECUT2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 21916-1-AP targets ONECUT2 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, mouse skin tissue, HEK-293 cells, HepG2 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ONECUT2, also named as One cut domain family member 2 or Hepatocyte nuclear factor 6-beta, is a 504 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT2 belongs to the CUT homeobox family and activates the transcription of a number of liver genes such as HNF3B. ONECUT2 is required for liver differnetiation and metabolism. ONECUT2 and ONECUT3 play redundant roles with ONECUT1 in pancreas development. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16162 Product name: Recombinant human ONECUT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-332 aa of BC108925 Sequence: PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE Predict reactive species Full Name: one cut homeobox 2 Calculated Molecular Weight: 504 aa, 54 kDa Observed Molecular Weight: 54-60 kDa GenBank Accession Number: BC108925 Gene Symbol: ONECUT2 Gene ID (NCBI): 9480 RRID: AB_2848180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924