Product Description
Size: 20ul / 150ul
The ONECUT2 (21916-1-AP) by Proteintech is a Polyclonal antibody targeting ONECUT2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples
21916-1-AP targets ONECUT2 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, A549 cells, mouse skin tissue, HEK-293 cells, HepG2 cells, Jurkat cells
Positive IP detected in: HEK-293 cells
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:200-1:800
Background Information
ONECUT2, also named as One cut domain family member 2 or Hepatocyte nuclear factor 6-beta, is a 504 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT2 belongs to the CUT homeobox family and activates the transcription of a number of liver genes such as HNF3B. ONECUT2 is required for liver differnetiation and metabolism. ONECUT2 and ONECUT3 play redundant roles with ONECUT1 in pancreas development.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16162 Product name: Recombinant human ONECUT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-332 aa of BC108925 Sequence: PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE Predict reactive species
Full Name: one cut homeobox 2
Calculated Molecular Weight: 504 aa, 54 kDa
Observed Molecular Weight: 54-60 kDa
GenBank Accession Number: BC108925
Gene Symbol: ONECUT2
Gene ID (NCBI): 9480
RRID: AB_2848180
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95948
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924