Proteintech, 21921-1-AP, VMA21 Polyclonal antibody

Size: 20ul / 150ul The VMA21 (21921-1-AP) by Proteintech is a Polyclonal antibody targeting VMA21 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 21921-1-AP targets VMA21 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, MCF-7 cells, human placenta tissue, mouse thymus tissue, HepG2 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: mouse brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16439 Product name: Recombinant human VMA21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC105694 Sequence: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD Predict reactive species Full Name: VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) Calculated Molecular Weight: 101 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC105694 Gene Symbol: VMA21 Gene ID (NCBI): 203547 RRID: AB_10896457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3ZAQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.